PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.1460s0094.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 290aa    MW: 33338 Da    PI: 5.5481
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.1460s0094.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-1790142456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          + +++ eq+++Le+ Fe  +++  e++ +LAk lg++ rq+ +WFqNrRa++k
  Bostr.1460s0094.1.p  90 KKRLQIEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWK 142
                          4457889*********************************************9 PP

2HD-ZIP_I/II123.69.4e-4088179192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekk+rl+ eqvk+LE+sFe  +kLeperK +la++Lg+qprq+a+WFqnrRAR+kt+qlE+dy++Lk+++++lk++n++L + +++L +e
  Bostr.1460s0094.1.p  88 EKKKRLQIEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWKTRQLERDYDSLKKQFESLKSDNDSLLAYNKKLLAE 177
                          69*************************************************************************************999 PP

          HD-ZIP_I/II  91 lk 92 
                          ++
  Bostr.1460s0094.1.p 178 VM 179
                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.11584144IPR001356Homeobox domain
SMARTSM003893.8E-1687148IPR001356Homeobox domain
SuperFamilySSF466892.99E-1887146IPR009057Homeodomain-like
CDDcd000862.56E-1589145No hitNo description
PfamPF000469.5E-1590142IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-1892152IPR009057Homeodomain-like
PRINTSPR000313.1E-5115124IPR000047Helix-turn-helix motif
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PRINTSPR000313.1E-5124140IPR000047Helix-turn-helix motif
PfamPF021835.1E-14145184IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MYVFDPTADA DAGLRLEMAF PQHGFMFQQL HEDNSQDQLP SCPPLLFNGG GNYMMNRSMS  60
LMNVQEDHNQ TLDEENLSDD GAHTMLGEKK KRLQIEQVKA LEKSFELGNK LEPERKIQLA  120
KALGMQPRQI AIWFQNRRAR WKTRQLERDY DSLKKQFESL KSDNDSLLAY NKKLLAEVMA  180
LKNKECNEAN IIKREAEASW SNNGSTENSS DINLEMPRET TTTHVNTIKD LFPSSIRSSA  240
HRGDDDHHQN HEMVQEESLC NMFNGIDETT SAGYWAWSDP NHNHHHQFN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00322DAPTransfer from AT3G01220Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2288900.0AK228890.1 Arabidopsis thaliana mRNA for putative homeobox-leucine zipper protein, complete cds, clone: RAFL16-20-K05.
GenBankAY0876310.0AY087631.1 Arabidopsis thaliana clone 3722 mRNA, complete sequence.
GenBankBT0292210.0BT029221.1 Arabidopsis thaliana At3g01220 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010485524.10.0PREDICTED: homeobox-leucine zipper protein ATHB-20-like
SwissprotQ8LAT00.0ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLD7LAH80.0D7LAH8_ARALL; ATHB20
STRINGscaffold_300109.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30952666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.10.0homeobox protein 20